DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and HOXD9

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:94 Identity:37/94 - (39%)
Similarity:51/94 - (54%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRP 98
            |:.:||.....||    :|..:...:|        |.|:.|..:|:.|...|||||....|::|.
Human   261 QHSQPQQQQLDPN----NPAANWIHAR--------STRKKRCPYTKYQTLELEKEFLFNMYLTRD 313

  Fly    99 RRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            ||.|:|..|||.|..:|:||||||||.|:
Human   314 RRYEVARILNLTERQVKIWFQNRRMKMKK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 28/55 (51%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 5/18 (28%)
Homeodomain 286..337 CDD:459649 24/50 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.