DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and CG11294

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:205 Identity:56/205 - (27%)
Similarity:84/205 - (40%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQ-RIAV-- 132
            ||.||.||..||..||..|.|.:|.....|.|:|.:::|.|:.::|||||||.|.::| |:.:  
  Fly    25 RRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARLQLLQ 89

  Fly   133 -AWPY--AAVYSDPAFAASILQAAANSVGMPYPP-YAP---AAAAAAAAAAAVATNPMMA--TGM 188
             ||..  .::.:.|......:|..:.:.....|| ..|   ::|:..:..|.|...|...  |.|
  Fly    90 DAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGSFTMM 154

  Fly   189 PPMGMPQMPTMQMPGHSGHAGHPSPYGQYR----YTPYHIPARPAPPHPAGPHMHHPHMMGSSAT 249
            .|....|....|      |.||.....|.:    ||...:...|:         |...:.|.:|.
  Fly   155 HPAFQQQHQQQQ------HQGHQQATDQDKLSKTYTELKLYKAPS---------HGMELGGMAAL 204

  Fly   250 GSSYSAGAAG 259
            ......|:.|
  Fly   205 SGHSDEGSDG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/51 (47%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451011
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.