DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and oc

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:446 Identity:102/446 - (22%)
Similarity:136/446 - (30%) Gaps:144/446 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNG------SRGSEIPADPSVR 71
            |.||.   |...||              ||..|...| .|....:|      |:|.........|
  Fly    22 HPHHS---VPHGPL--------------PPGMPMPSL-GPFGLPHGLEAVGFSQGMWGVNTRKQR 68

  Fly    72 RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPY 136
            |.||.|||.||..||..|.|..|.....|.|:|.::|||||.::|||:|||.| .||::......
  Fly    69 RERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAK-CRQQLQQQQQS 132

  Fly   137 AAVYSD----------------------------------------------------------- 142
            .::.|.                                                           
  Fly   133 NSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQSSQQGG 197

  Fly   143 --------------PAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMPPMGM 193
                          .|.:|:...|||.|:...:..:..||||||:.....:.|............
  Fly   198 GSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSANNNSNNNNQGNST 262

  Fly   194 PQMPTMQMPGHS---GHAGHPSPYGQYRYTPYHIPARPAPPHPA---GP--------HMHHPHMM 244
            |...:....|.|   ||....:.......|..|..:.|..|.||   .|        |:      
  Fly   263 PNSSSSGGGGGSQAGGHLSAAAAAAALNVTAAHQNSSPLLPTPATSVSPVSIVCKKEHL------ 321

  Fly   245 GSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSD--- 306
             |...|||...|..|  |...|.....|:||||.......:......||:.   .|...|.|   
  Fly   322 -SGGYGSSVGGGGGG--GGASSGGLNLGVGVGVGVGVGVGVSQDLLRSPYD---QLKDAGGDIGA 380

  Fly   307 ----HAKVFDRSPVAQSAPSVPAP----APLTTTSPLPAPGLLMPSAKRPASDMSP 354
                |..::  ...|.|.|.:..|    .|:.::|.:..|       ..|.:.|||
  Fly   381 GVHHHHSIY--GSAAGSNPRLLQPGGNITPMDSSSSITTP-------SPPITPMSP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 27/51 (53%)
ocNP_001356934.1 Homeobox 71..123 CDD:333795 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451030
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.