DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Vsx1

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:277 Identity:65/277 - (23%)
Similarity:99/277 - (35%) Gaps:69/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHGYRTYNMESHHAH-HDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEI 64
            :|.:..:...:.||| |.|..         .|....|....|            |||..:.|.::
  Fly   335 VHAHAAHAAHAAHAHAHHAEA---------FLGAAGGAGGNP------------NSLLAAHGGDV 378

  Fly    65 PADP----------SVRRY-RTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWF 118
            ...|          :.||: ||.||..||..|||.|.:.:|.....|..|:.:..|.|..|:||:
  Fly   379 LVGPGGTGPGGKKKNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWY 443

  Fly   119 QNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPM 183
            ||||.|.::..  ..|.::...::.....::::.:     :|.|.....:|....:.|     |.
  Fly   444 QNRRAKWRKTE--KCWGHSTKMAEYGLYGAMVRHS-----LPLPETIIKSAKEDESVA-----PW 496

  Fly   184 MATGMPPMGMP------------QMPTMQMPGHSGHAG--HPSPYGQYRYTPYHIPARPAPPHPA 234
            : .||....:.            :.||......|..||  |.||...:..:....   .|||..|
  Fly   497 L-LGMHKKSLEAAELLKSDESDRETPTSDDTNTSYSAGSTHNSPISSFSISRLLF---DAPPPAA 557

  Fly   235 GP------HMHHPHMMG 245
            |.      |.||.|..|
  Fly   558 GSAGGKGHHHHHHHHKG 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 23/51 (45%)
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450970
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.