DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Vsx2

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:353 Identity:88/353 - (24%)
Similarity:131/353 - (37%) Gaps:69/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MESHHAHHDASPVDQKPLVVDLLATQYGKPQTP--PPSPNECLS---SPDN----SLNG-SRGSE 63
            |:.||.||...|         ||..| |.||..  ......||.   :|.:    |||| ..|..
  Fly   168 MQHHHPHHPHHP---------LLHAQ-GFPQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPN 222

  Fly    64 IPADPSVRRY-RTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMK-DK 126
            .......||: ||.||..||.:||:.|.:.:|.....|..|:.:..|||..|:|||||||.| .|
  Fly   223 SKKKKKKRRHSRTIFTSYQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRK 287

  Fly   127 RQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMPPM 191
            .:::   |..:.:.::.....::::.:     :|.|.....:|....|.|     |.:      :
  Fly   288 TEKV---WGGSTIMAEYGLYGAMVRHS-----LPLPDTILKSAKDNDAVA-----PWL------L 333

  Fly   192 GMPQM--------PTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMMGSS- 247
            ||.|.        ....:...||.:.|....|.            ...|.........|.:.|| 
  Fly   334 GMEQKCMHRKSIEAQSALKDDSGVSDHEDSAGS------------KSAHSEDLSRSRCHALSSST 386

  Fly   248 -----ATGSSYSAGAAGLLGALPSATC-YTGLGVGVPKTQTPPLDLQSSSSPHSSTLSLSPVGSD 306
                 .:.:..|...:....|.|::|. |.|.......|.|......||||||....|.||....
  Fly   387 ESLNVVSPAPSSCPTSASTSAPPTSTSGYAGAASSAATTPTGASTTNSSSSPHIELGSPSPQQQQ 451

  Fly   307 HAKVFDRSPVAQSAPSVPAPAPLTTTSP 334
            |.:: .:....|::..:.|.|.:|..:|
  Fly   452 HLQL-QQQQQQQASLYLGAGAVVTGCAP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/52 (46%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 24/52 (46%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450969
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.