DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and hoxa13b

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571269.2 Gene:hoxa13b / 30438 ZFINID:ZDB-GENE-980526-365 Length:289 Species:Danio rerio


Alignment Length:78 Identity:25/78 - (32%)
Similarity:49/78 - (62%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTI 114
            ||..::::|:.|:.:...   |:.|..:|:.||..||:|:....::::.:|..::|..||.|..:
Zfish   206 SSIQDTVSGTDGASVRRG---RKKRVPYTKVQLKELEREYATNKFITKDKRRRISAHTNLTERQV 267

  Fly   115 KVWFQNRRMKDKR 127
            .:||||||:|:|:
Zfish   268 TIWFQNRRVKEKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 20/55 (36%)
hoxa13bNP_571269.2 HoxA13_N 27..131 CDD:463521
Homeodomain 224..280 CDD:459649 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.