DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and eve1

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005171610.1 Gene:eve1 / 30335 ZFINID:ZDB-GENE-980526-69 Length:224 Species:Danio rerio


Alignment Length:213 Identity:88/213 - (41%)
Similarity:112/213 - (52%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQN 120
            |||       .|.| ||:||||||:||.|||:|:.||:||||||||||||.|||||:||||||||
Zfish    31 LNG-------IDQS-RRHRTAFTREQLTRLEQEYCKESYVSRPRRCELAAALNLPETTIKVWFQN 87

  Fly   121 RRMKDKRQRIAVAWPYAAVYSDPAFAASIL-QAAANSVGMPYP--PYAP---------AAAAAAA 173
            |||||||||.::.||...   ||...|.:: |.||   .:|||  |..|         .:.:..:
Zfish    88 RRMKDKRQRHSLHWPNPL---DPNLCAFMVGQTAA---ALPYPLLPRLPIHLYSHLGMGSLSGFS 146

  Fly   174 AAAAVATNPMMATGMPPM------GMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPH 232
            ...:..|.|:....:||.      |:|| |.:..|..:.|  ||...    :.|..:..||    
Zfish   147 TPYSATTRPVDTLHLPPSTYPWLGGLPQ-PALYSPVQTMH--HPVGC----HCPQCLQWRP---- 200

  Fly   233 PAGPHMHHPHMMGSSATG 250
               .|:..|.  |.:.||
Zfish   201 ---DHLLKPR--GGARTG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 43/51 (84%)
eve1XP_005171610.1 Homeobox 40..93 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002730
OrthoInspector 1 1.000 - - otm25513
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46294
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.