DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and GBX2

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:120 Identity:42/120 - (35%)
Similarity:56/120 - (46%) Gaps:27/120 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRR 72
            |:....||.:..|             .:...:|||.|             |:.||......: ||
Human   212 NLTGQAAHKEEDP-------------GHALEETPPSS-------------GAAGSTTSTGKN-RR 249

  Fly    73 YRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            .|||||.:||..|||||:.:.|:|...|.::|..|.|.|..:|:||||||.|.||
Human   250 RRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 29/55 (53%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 13/65 (20%)
Homeodomain 248..304 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.