DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and GBX1

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:91 Identity:39/91 - (42%)
Similarity:48/91 - (52%) Gaps:13/91 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LSSPDNSLNGSRGS------------EIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRC 101
            |..|...|.||.|:            ..|...| ||.|||||.:||..|||||:.:.|:|...|.
Human   229 LLGPKPKLKGSLGTGAEEGAPVTAGVTAPGGKS-RRRRTAFTSEQLLELEKEFHCKKYLSLTERS 292

  Fly   102 ELAAQLNLPESTIKVWFQNRRMKDKR 127
            ::|..|.|.|..:|:||||||.|.||
Human   293 QIAHALKLSEVQVKIWFQNRRAKWKR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 29/55 (53%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 10/36 (28%)
Homeodomain 262..318 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.