DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and EVX1

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001980.1 Gene:EVX1 / 2128 HGNCID:3506 Length:407 Species:Homo sapiens


Alignment Length:306 Identity:112/306 - (36%)
Similarity:147/306 - (48%) Gaps:61/306 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGS-EIPADPS 69
            |.|.|..|:....|..        |:.:..|..:||.       |:..:...||:|: ...|...
Human   133 TGNAEYQHSKGSGSEA--------LVGSPNGGSETPK-------SNGGSGGGGSQGTLACSASDQ 182

  Fly    70 VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAW 134
            :|||||||||:|:.|||||||:||||||||||||||.|||||:|||||||||||||||||:|:.|
Human   183 MRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTW 247

  Fly   135 PYAAVYSDPAFAASILQAAANSVGMPYP-------PYAPAAAAAAAAAAAVATNPMMATGMPPMG 192
            |:.|   ||||...::..||.:.|:|||       ||.......||:||:.|.:|...:..|   
Human   248 PHPA---DPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRP--- 306

  Fly   193 MPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPAPPHPAGPHMHHPHMMGSSATGSSYSAGA 257
               :.|.::      ...|.|..:......|.|..|.|.|                 |...||| 
Human   307 ---LDTFRV------LSQPYPRPELLCAFRHPPLYPGPAH-----------------GLGASAG- 344

  Fly   258 AGLLGALPSATCYTGLGVGVPKTQTPPLDLQSSSSPHS-STLSLSP 302
                |......|::|...|:........|...:|:..| |.|:.:|
Human   345 ----GPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 45/51 (88%)
EVX1NP_001980.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..179 11/56 (20%)
HOX 183..239 CDD:197696 48/55 (87%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6253
eggNOG 1 0.900 - - E1_KOG0844
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4277
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002730
OrthoInspector 1 1.000 - - otm40654
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.