DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and ceh-30

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:205 Identity:65/205 - (31%)
Similarity:84/205 - (40%) Gaps:44/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRR 72
            |..||...||.||...|.   |.        .|.|.:     |||.....||.||    ....|:
 Worm    53 NNSSHSNDHDPSPQSIKS---DF--------STSPRA-----SSPGGDRMGSPGS----CKKSRK 97

  Fly    73 YRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIAVAWPYA 137
            .||.||..||..||..|.|:.|:|...|.:||.::.|.::.:|.|:||||.|.|||    |....
 Worm    98 ARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQ----ATSGM 158

  Fly   138 AVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAVATNPMMATGMPPMGMPQMPTMQMP 202
            .:.|:|...:::.....:|      ||          .|...|...|.|.:|.||:|    |.|.
 Worm   159 DLLSEPGNLSAVQNLIRSS------PY----------WANYITALPMGTQLPMMGLP----MSMI 203

  Fly   203 GHSGHAGHPS 212
            ....||..||
 Worm   204 VPPAHAFQPS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 23/51 (45%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3983
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.