DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Nkx6-1

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_659204.1 Gene:Nkx6-1 / 18096 MGIID:1206039 Length:365 Species:Mus musculus


Alignment Length:145 Identity:40/145 - (27%)
Similarity:57/145 - (39%) Gaps:46/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLATQYGKPQ----TPPPSPNECLSSPDNSLNGSRG------SEIPA------------------ 66
            |||   |.|:    :|||.|.....||..:...:.|      :|:|.                  
Mouse   157 LLA---GLPRFSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDA 218

  Fly    67 ---------------DPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKV 116
                           |...:..|..|:..|:..|||.|.:..|::.|.|..||..|.:.||.:||
Mouse   219 RLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKV 283

  Fly   117 WFQNRRMKDKRQRIA 131
            ||||||.|.:::..|
Mouse   284 WFQNRRTKWRKKHAA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 24/55 (44%)
Nkx6-1NP_659204.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136
Repressor domain. /evidence=ECO:0000250 102..269 25/114 (22%)
Homeodomain 236..294 CDD:459649 24/57 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 1/4 (25%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.