DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Meox2

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus


Alignment Length:186 Identity:54/186 - (29%)
Similarity:74/186 - (39%) Gaps:69/186 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQ-TPPPS--------------PNECLSSP- 52
            :|.::...||.||.......:     .|.:.:..|| :.|||              |.|..||| 
Mouse    65 HRGHHHHHHHHHHHHQQQQHQ-----ALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELGSSPP 124

  Fly    53 ----------------------------------------------DNSLNGSRGSEIPADPSVR 71
                                                          .:|..|:..||:.:.|  |
Mouse   125 VLCSNSSSLGSSTPTGAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQEGNYKSEVNSKP--R 187

  Fly    72 RYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            :.|||||::|:..||.||...||::|.||.|:|..|:|.|..:||||||||||.||
Mouse   188 KERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 31/55 (56%)
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 22/132 (17%)
Homeodomain 187..243 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.