DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Lbx1

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_034821.2 Gene:Lbx1 / 16814 MGIID:104867 Length:282 Species:Mus musculus


Alignment Length:95 Identity:32/95 - (33%)
Similarity:42/95 - (44%) Gaps:26/95 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSR 97
            |.:|:.|||...                          |:.|||||..|:..|||.|..:.|:|.
Mouse   114 TIFGQRQTPKKR--------------------------RKSRTAFTNHQIYELEKRFLYQKYLSP 152

  Fly    98 PRRCELAAQLNLPESTIKVWFQNRRMKDKR 127
            ..|.::|.||.|..:.:..||||||.|.||
Mouse   153 ADRDQIAQQLGLTNAQVITWFQNRRAKLKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 25/55 (45%)
Lbx1NP_034821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Homeodomain 126..182 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.