DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Hoxa4

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:177 Identity:50/177 - (28%)
Similarity:68/177 - (38%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PQTPPPSPNECLSSP-------------------DNSLNGSRGSEIPADP--------------- 68
            || ||..|..|...|                   |....|.:|.|....|               
Mouse   113 PQ-PPAPPRHCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNSSYN 176

  Fly    69 --SVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQRIA 131
              ..:|.|||:||.|:..|||||:...|::|.||.|:|..|.|.|..:|:||||||||.|:..  
Mouse   177 GGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDH-- 239

  Fly   132 VAWPYAAVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAAAV 178
             ..|...:.|....:|............|:|...|...|:....:::
Mouse   240 -KLPNTKMRSSNTASAPAGPPGKAQTHSPHPHPHPLPGASTPIPSSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 30/55 (55%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70
PHA03247 <43..161 CDD:223021 11/48 (23%)
Antp-type hexapeptide 159..164 1/4 (25%)
Homeodomain 181..237 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.