DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Hesx1

DIOPT Version :10

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_034550.2 Gene:Hesx1 / 15209 MGIID:96071 Length:185 Species:Mus musculus


Alignment Length:90 Identity:36/90 - (40%)
Similarity:47/90 - (52%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PSPNECLSSPDNSLNGSRGSEIPADPS---VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELA 104
            |.|.|.....:|..:.|....:..:.|   .||.|||||::|:..||..|....|.....|.:||
Mouse    78 PRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLA 142

  Fly   105 AQLNLPESTIKVWFQNRRMKDKRQR 129
            .:|||.|..|::||||||.|.||.|
Mouse   143 QKLNLEEDRIQIWFQNRRAKMKRSR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeodomain 71..127 CDD:459649 27/55 (49%)
Hesx1NP_034550.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..69
Homeodomain 109..165 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.