DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and Alx3

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_031467.1 Gene:Alx3 / 11694 MGIID:1277097 Length:343 Species:Mus musculus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:100/266 - (37%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SHHAHHDASPVDQKP-LVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSV---- 70
            |..|...||.....| |.||........|.....||..||:|          ..:|..|.:    
Mouse    90 SAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLAS----------LSVPLSPGLPDSM 144

  Fly    71 ---------RRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMK-D 125
                     ||.||.|:..||..|||.|.|.:|.....|.:||.:.:|.|:.::|||||||.| .
Mouse   145 ELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWR 209

  Fly   126 KRQRIAVAW----PYAAVY---------SDPAFAASILQAAANS----------VGMPYPPYAPA 167
            ||:|.....    |:...|         |.|....|:..:..:.          .|:|.|..:|.
Mouse   210 KRERYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWPSPGSGSPGGPCLMSPEGIPSPCMSPY 274

  Fly   168 AAAAAAAAA--AVATNPMMATGMPPM-GMPQMPTMQMPGHSGHAGHPSPYGQYRYTPYHIPARPA 229
            :.:....|.  .|..:|....|:..: |.|       |...||:..|||.|.|: :|..:..|..
Mouse   275 SHSHGNVAGFMGVPASPAAHPGIYSIHGFP-------PALGGHSFEPSPDGDYK-SPSLVSLRMK 331

  Fly   230 PPHPAG 235
            |..|.|
Mouse   332 PKEPPG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 24/52 (46%)
Alx3NP_031467.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..122 9/31 (29%)
SP2 32..>141 CDD:281067 16/60 (27%)
Homeobox 157..209 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..343 12/30 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.