DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eve and evx2

DIOPT Version :9

Sequence 1:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002935724.3 Gene:evx2 / 100498260 XenbaseID:XB-GENE-852923 Length:502 Species:Xenopus tropicalis


Alignment Length:315 Identity:123/315 - (39%)
Similarity:161/315 - (51%) Gaps:81/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSPD--NSLNGSR--GSEIPADPSVRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLP 110
            |:|.  .||||..  ||...|...||||||||||:|:||||||||:||||||||||||||.||||
 Frog   230 STPSGIGSLNGLNPVGSSSSAADQVRRYRTAFTREQIGRLEKEFYRENYVSRPRRCELAAALNLP 294

  Fly   111 ESTIKVWFQNRRMKDKRQRIAVAWPYAAVYSDPAFAASILQAAANSVGMPYP----------PY- 164
            |:|||||||||||||||||:|::||:.|   ||:|...::..||.:..:|||          |: 
 Frog   295 ETTIKVWFQNRRMKDKRQRLAMSWPHPA---DPSFYTYMMTHAAATGSLPYPFHSHVPLHYYPHV 356

  Fly   165 ---APAAAAAAAAAAAVATNPMMATGMPPMGMPQMPTMQMPGHSGHAGHPSPYGQ------YRYT 220
               |.||||||:.|||.|.:| .||.:.|     :.|.:...|        ||.:      :|:.
 Frog   357 GVTAAAAAAAASGAAAAAASP-FATSIRP-----LDTFRALSH--------PYSRPELLCSFRHP 407

  Fly   221 P-YHIPARPAPPHPAGPHMHHPHMMGSSATGSSYSAGAAGLLGALPSATCYTGLGVGVPKTQTPP 284
            . |..||                  |.::|.::.:|.||....:.|.:              :|.
 Frog   408 GLYQSPA------------------GINSTAAAAAAAAAAAAASAPGS--------------SPC 440

  Fly   285 LDLQSSSSPHSSTLSLSPVGSDHAKVFDRSPVAQSAPSVPAP---APLTTTSPLP 336
            ..|...|:..:|.|..:..|||    |..:..:|.:.|...|   |.|:.||..|
 Frog   441 SCLSCHSNQTASALGSASRGSD----FTCTAASQRSESSFLPYSAAVLSKTSVSP 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eveNP_523670.2 Homeobox 74..126 CDD:278475 46/51 (90%)
evx2XP_002935724.3 Homeobox 258..311 CDD:395001 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6015
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002730
OrthoInspector 1 1.000 - - otm47830
Panther 1 1.100 - - LDO PTHR46294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2525
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.100

Return to query results.
Submit another query.