DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12134 and wdr89

DIOPT Version :9

Sequence 1:NP_001369072.1 Gene:CG12134 / 36038 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001016604.1 Gene:wdr89 / 549358 XenbaseID:XB-GENE-1007512 Length:383 Species:Xenopus tropicalis


Alignment Length:396 Identity:110/396 - (27%)
Similarity:186/396 - (46%) Gaps:46/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDTCSAQDLAAEFQLKYKPQDEVSVSLQREYVLSLAADQGFSRMAAGLSNSAVHIYNLDSGAGKL 92
            |:..|...||....:|.|....|.:.|.:.     ...:...::|...||.:|.:|  |.|    
 Frog     5 EEQLSHLHLARRCAVKDKQTYVVDIDLSKP-----TEGENDEKIAILCSNKSVQLY--DKG---- 58

  Fly    93 ENFSYLPPTDSPQSVSICGVRFLDEGPHNILVGTTDGYVRLYDLRLRGEQARFKYTQHPNVPPVP 157
             ..:::...:....| :..|:|.......:....:||.|:.:|.|:.|..|...:|.:|:     
 Frog    59 -TMTFIREYNGHPGV-LSEVKFSHSNRLILSSACSDGTVKSWDTRVSGTDAIQIFTGYPS----- 116

  Fly   158 KSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVR--------ERQQMGVYFESHEDDITSLRFHA 214
            .:...||.:.|..::|.|||:...:|||||:|.|        .:..:|||.|||.||||.:.||.
 Frog   117 NAFISFDISCNDFVVCAGTEKVEEDAFLVFWDARYNSENKSARQDPLGVYAESHFDDITKVCFHP 181

  Fly   215 QNPDLLATGSVDGLVNVFDVKEPDEDEALLNTFNTESSVARLAWHRNVYDKDIISCVTTTGDFKS 279
            .||.::|:||.|||||||::.:.:||:||.:|.|::|||:.|.|...  |.:.|.|:|....|..
 Frog   182 TNPSMVASGSTDGLVNVFNISKDNEDDALDSTCNSDSSVSSLGWAGK--DSNQIFCLTHDEGFYW 244

  Fly   280 YECEEGDEVASFERPDVTAAIR--RKKAANFN---LINA--HNQEDGGVFLLAGTNFNKGEILRS 337
            ::..:.|.    .:|...:.|:  |::....|   ||..  |.:|| .:||:.|::.....:|: 
 Frog   245 WDLAQIDT----NKPITLSKIQDVREEFGTHNVDYLIGGIYHKKED-TLFLVGGSHSGNVNLLK- 303

  Fly   338 VSVTSKNSLQPLANFQ-GNKQIVRDSLFDSKRSLLFTGGESGIVTVWAQDASGTA-FSSEKLKAR 400
               .|.:.::.|.... |:...:|...:|.....|.||||...:.:|.|::.|.: ...:.:|..
 Frog   304 ---CSNDGVKHLKTLHGGHSATIRSFYWDFGDDSLLTGGEDAQLLIWKQESQGASPLKKDSMKIA 365

  Fly   401 KEKKSR 406
            ...:.|
 Frog   366 SSVQQR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12134NP_001369072.1 WD40 56..384 CDD:421866 97/343 (28%)
WD40 repeat 59..101 CDD:293791 7/41 (17%)
WD40 repeat 108..146 CDD:293791 9/37 (24%)
WD40 repeat 153..201 CDD:293791 17/55 (31%)
WD40 repeat 207..248 CDD:293791 21/40 (53%)
WD40 repeat 300..353 CDD:293791 14/59 (24%)
WD40 repeat 359..390 CDD:293791 9/30 (30%)
wdr89NP_001016604.1 WD40 repeat 27..68 CDD:293791 9/52 (17%)
WD40 <39..257 CDD:295369 75/236 (32%)
WD40 <40..367 CDD:225201 101/350 (29%)
WD40 repeat 73..112 CDD:293791 9/38 (24%)
WD40 repeat 174..215 CDD:293791 21/40 (53%)
WD40 repeat 220..245 CDD:293791 8/26 (31%)
WD40 repeat 277..316 CDD:293791 10/43 (23%)
WD40 repeat 323..347 CDD:293791 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43791
Inparanoid 1 1.050 129 1.000 Inparanoid score I4522
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1546666at2759
OrthoFinder 1 1.000 - - FOG0005225
OrthoInspector 1 1.000 - - oto103827
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.