DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12134 and Y54H5A.1

DIOPT Version :9

Sequence 1:NP_001369072.1 Gene:CG12134 / 36038 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_498091.1 Gene:Y54H5A.1 / 175701 WormBaseID:WBGene00021899 Length:453 Species:Caenorhabditis elegans


Alignment Length:303 Identity:55/303 - (18%)
Similarity:103/303 - (33%) Gaps:94/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EDEEDIGDEDTCS---AQDLAAEFQLKYKPQDEVSVSLQREYVLSLAADQGFSRM---------- 71
            :::|:.||:...|   ::|..||.:.|.:|         :.:.:|:....|.:|:          
 Worm   126 KEKENKGDDSDTSEDESEDEDAEEEKKREP---------KMHAVSIPHYGGINRIRSDRLGDSTV 181

  Fly    72 -AAGLSNSAVHIYNLD---------SGAGKLENFSYLPPTDSPQSVSICGVRFLDEGPHNILVGT 126
             |.......|.::|:.         ||..|.|    :...|.|        .|.:.|      ..
 Worm   182 CACWSDQGRVQVWNITDALNYTHGMSGESKTE----VQKIDRP--------LFTNNG------SG 228

  Fly   127 TDGYVRLYDLRLRGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVR 191
            .:||...:.....|:.                        |.|.||          ..:..:.::
 Worm   229 KEGYGLAWSSLKTGDL------------------------ATGDII----------KKIYLWQMK 259

  Fly   192 ERQQMGV---YFESHEDDITSLRFHAQNPDLLATGSVDGLVNVFDVKEPDEDEALLNTFNT-ESS 252
            |..|..|   ....|:..:..|.:......|||:.|.||.:.::|.:...:|..:...... ||.
 Worm   260 EGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESD 324

  Fly   253 VARLAWHRNVYDKDIISCVTTTGDFKSYECEE---GDEVASFE 292
            |..::|:|:   :::|......|:.|.:..:.   |..||.|:
 Worm   325 VNVISWNRH---ENLIVSGGDDGELKIWSLKTIQFGQPVALFK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12134NP_001369072.1 WD40 56..384 CDD:421866 46/264 (17%)
WD40 repeat 59..101 CDD:293791 10/61 (16%)
WD40 repeat 108..146 CDD:293791 5/37 (14%)
WD40 repeat 153..201 CDD:293791 7/50 (14%)
WD40 repeat 207..248 CDD:293791 9/40 (23%)
WD40 repeat 300..353 CDD:293791
WD40 repeat 359..390 CDD:293791
Y54H5A.1NP_498091.1 CAF1C_H4-bd 54..122 CDD:372002
WD40 182..>401 CDD:392136 43/238 (18%)
WD40 repeat 232..273 CDD:293791 9/74 (12%)
WD40 repeat 278..318 CDD:293791 9/39 (23%)
WD40 repeat 326..364 CDD:293791 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.