DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12134 and WDR89

DIOPT Version :9

Sequence 1:NP_001369072.1 Gene:CG12134 / 36038 FlyBaseID:FBgn0033471 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_011534685.1 Gene:WDR89 / 112840 HGNCID:20489 Length:425 Species:Homo sapiens


Alignment Length:417 Identity:124/417 - (29%)
Similarity:191/417 - (45%) Gaps:62/417 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DIGDEDTCSAQDLAAEFQLKYKPQDE-------VSVSL---QREYVL----SLAADQGFSRMAAG 74
            :.|...|||...|..:..:..:..:|       |..||   :..|:|    |.....|...:.|.
Human    19 EAGASLTCSRVLLPLDAAVDMEKIEEQFANLHIVKCSLGTKEPTYLLGIDTSKTVQAGKENLVAV 83

  Fly    75 L-SNSAVHIYNLDSGAGKLENFSYLPPTDSPQSVSICGVRFLDEGPHNILVGTTDGYVRLYDLRL 138
            | ||.::.||:.:. ...|..||..|..       :.||||.: ...::....|||.|:.:|.|:
Human    84 LCSNGSIRIYDKER-LNVLREFSGYPGL-------LNGVRFAN-SCDSVYSACTDGTVKCWDARV 139

  Fly   139 RGEQARFKYTQHPNVPPVPKSLSCFDRNANGRIICCGTEQFHSNAFLVFFDVRERQQ-------- 195
            ..|:....:..:|:     .....||.|.|..|||.|||:...:|.|||:|.|...|        
Human   140 AREKPVQLFKGYPS-----NIFISFDINCNDHIICAGTEKVDDDALLVFWDARMNSQNLSTTKDS 199

  Fly   196 MGVYFESHEDDITSLRFHAQNPDLLATGSVDGLVNVFDVKEPDEDEALLNTFNTESSVARLAWHR 260
            :|.|.|:|.||:|.:|||..||:::.:||.||||||||:...:|::||:.|.|:.|||:.:.|..
Human   200 LGAYSETHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDNEEDALVTTCNSISSVSCIGWSG 264

  Fly   261 NVYDKDIISCVTTTGDFKSYECE--EGDE-VASFERPDVTAAIRRKKAANFNLINA-HNQEDGGV 321
            ..|.:  |.|:|....|..::..  :.|| |......||...:..|:.|...||.. ::::...:
Human   265 KGYKQ--IYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLYHEKTDTL 327

  Fly   322 FLLAGTNFNKGEI-LRSVS---VTSKNSLQPLANFQGNKQIVRDSLFDSKRSLLFTGGESGIVTV 382
            .::.||  |||.| |.:.|   :|...|||     .|:...||...::.:...|.||||...:.:
Human   328 HVIGGT--NKGRIHLMNCSMSGLTHVTSLQ-----GGHAATVRSFCWNVQDDSLLTGGEDAQLLL 385

  Fly   383 WAQDASGTAFSSEKLKARKEKKSRKQA 409
            |...|....|:        :|:|.|.|
Human   386 WKPGAIEKTFT--------KKESMKIA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12134NP_001369072.1 WD40 56..384 CDD:421866 108/348 (31%)
WD40 repeat 59..101 CDD:293791 13/46 (28%)
WD40 repeat 108..146 CDD:293791 11/37 (30%)
WD40 repeat 153..201 CDD:293791 19/55 (35%)
WD40 repeat 207..248 CDD:293791 20/40 (50%)
WD40 repeat 300..353 CDD:293791 16/57 (28%)
WD40 repeat 359..390 CDD:293791 9/30 (30%)
WDR89XP_011534685.1 WD40 69..>387 CDD:225201 106/340 (31%)
WD40 79..387 CDD:295369 104/330 (32%)
WD40 repeat 112..150 CDD:293791 11/38 (29%)
WD40 repeat 156..198 CDD:293791 17/41 (41%)
WD40 repeat 212..250 CDD:293791 19/37 (51%)
WD40 repeat 257..297 CDD:293791 10/41 (24%)
WD40 repeat 305..355 CDD:293791 14/51 (27%)
WD40 repeat 362..386 CDD:293791 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43791
Inparanoid 1 1.050 129 1.000 Inparanoid score I4672
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54464
OrthoDB 1 1.010 - - D1546666at2759
OrthoFinder 1 1.000 - - FOG0005225
OrthoInspector 1 1.000 - - oto90016
orthoMCL 1 0.900 - - OOG6_103591
Panther 1 1.100 - - LDO PTHR22889
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.