DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3j and AT1G66070

DIOPT Version :9

Sequence 1:NP_001286260.1 Gene:eIF3j / 36037 FlyBaseID:FBgn0027619 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001185326.1 Gene:AT1G66070 / 842921 AraportID:AT1G66070 Length:226 Species:Arabidopsis thaliana


Alignment Length:238 Identity:78/238 - (32%)
Similarity:124/238 - (52%) Gaps:17/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDWESAADSEVVIRPTAAASVNKWEGEDEDE-DIKDSWEDEEEKKDEEKPTKTEAPAKPKPNKAL 66
            ||||   |.::...|......:.|:.||.|| :|||||||::: :..:.|....||.| .|.||.
plant     2 DDWE---DEKIAPLPAKVELKSNWDDEDVDENEIKDSWEDDDD-EPAQPPVINPAPEK-APKKAA 61

  Fly    67 KAKLEQQA-LLEEEAEAKRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTSTCGGLDAFNP 130
            ...:|::. .:|...||.:...|.|   :|||||.|::.|.:|.:...|.|||......||.|.|
plant    62 PKTVEKKGKAVEVPKEAPKEKPLDP---IAEKLRQQRLVEEADYRATAELFGVKDDDKNLDMFIP 123

  Fly   131 ETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEK 195
            :::.:|.|:...:|.::..:.:|.|:...::.::|....|:.|||:|.|..::..:.:||||.||
plant   124 KSESDFLEYAEMISHRIKPYEKSYHYIALLKTIMRLSLTNMKAADVKDVASSITTIANEKLKAEK 188

  Fly   196 --ANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM 236
              |..||..||.|..:..:..:|.:.|.....:||     |||
plant   189 EAAAGKKKGGKKKQLIVDKANDDLVAGPYDAMDDF-----DFM 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3jNP_001286260.1 eIF3_subunit 3..236 CDD:285763 76/236 (32%)
AT1G66070NP_001185326.1 eIF3_subunit 1..185 CDD:400769 61/190 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1976
eggNOG 1 0.900 - - E1_KOG4813
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2020
OMA 1 1.010 - - QHG55542
OrthoDB 1 1.010 - - D1565510at2759
OrthoFinder 1 1.000 - - FOG0004066
OrthoInspector 1 1.000 - - otm3567
orthoMCL 1 0.900 - - OOG6_103515
Panther 1 1.100 - - LDO PTHR21681
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.