DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3j and AT5G37475

DIOPT Version :9

Sequence 1:NP_001286260.1 Gene:eIF3j / 36037 FlyBaseID:FBgn0027619 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001330000.1 Gene:AT5G37475 / 833725 AraportID:AT5G37475 Length:225 Species:Arabidopsis thaliana


Alignment Length:240 Identity:80/240 - (33%)
Similarity:129/240 - (53%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDWESAADSEVVIRPTAAASVNKWEGEDEDE-DIKDSWEDEEEKKDEE--KPTKTEAPAKPKPNK 64
            |||| |.|.:.:  |:.....:.|:.||.|| |||||||:|:......  ||...:||.||.. |
plant     2 DDWE-AEDFQPL--PSKVELKSNWDDEDVDENDIKDSWEEEDVSAPPPIVKPASEKAPKKPAV-K 62

  Fly    65 ALKAKLEQQALLEEEAEA-KRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTSTCGGLDAF 128
            |::.|:       :..|| |..:...|.:.:|||||:|::.|.:|.:...|.|||.:....:|..
plant    63 AVEKKV-------KTVEAPKGTSREEPLDPIAEKLRMQRLVEEADYQSTAELFGVKTEEKSVDML 120

  Fly   129 NPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKL 193
            .|:::.:|.::...:|.::..|.:|.|:...::.::|....|:.|||:|.|..::..:.:||||.
plant   121 IPKSESDFLDYAELISQRLVPFEKSFHYIGLLKAVMRLSVANMKAADVKDVASSITAIANEKLKA 185

  Fly   194 EK--ANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM 236
            ||  |..||.:||.|.....:.::|.:.|  .|  |..:| ||||
plant   186 EKEAAAGKKKSGKKKQLHVDKPDDDLVSG--PY--DAMDD-DDFM 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3jNP_001286260.1 eIF3_subunit 3..236 CDD:285763 78/238 (33%)
AT5G37475NP_001330000.1 eIF3_subunit 1..224 CDD:400769 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 116 1.000 Domainoid score I1976
eggNOG 1 0.900 - - E1_KOG4813
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2020
OMA 1 1.010 - - QHG55542
OrthoDB 1 1.010 - - D1565510at2759
OrthoFinder 1 1.000 - - FOG0004066
OrthoInspector 1 1.000 - - otm3567
orthoMCL 1 0.900 - - OOG6_103515
Panther 1 1.100 - - O PTHR21681
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.