DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3j and SPAC3A12.13c

DIOPT Version :9

Sequence 1:NP_001286260.1 Gene:eIF3j / 36037 FlyBaseID:FBgn0027619 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_593339.1 Gene:SPAC3A12.13c / 2543108 PomBaseID:SPAC3A12.13c Length:274 Species:Schizosaccharomyces pombe


Alignment Length:284 Identity:68/284 - (23%)
Similarity:115/284 - (40%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDWESAADSEVVIRPTAAASVNKWEGEDEDEDIK-----DSWEDEEEKKDEEKPTKTEAPAKPKP 62
            |.||..    :|..|...|..:...|:|.....|     |..|||:|::::|...........|.
pombe     2 DSWEDF----LVEDPAKPAEFDFPLGKDSQSSSKPKKRFDDEEDEDEEENKESLQNDSHSVSQKS 62

  Fly    63 NKA------------LKAKLE----QQALLEEEAEAKRLANLSPAEKLAEKLRLQKIQEASDLKH 111
            :.:            ::.|::    ::|:...||.||.    ...|...|.:|..:|.  |||.:
pombe    63 SSSSQNDQGSNKMTRIQQKIQERNFEKAIKASEAAAKE----ESLESSKEAMRQAEID--SDLAN 121

  Fly   112 AQEAFGVTSTCGG-------LDAFNPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCV 169
            |.:.|.:......       .|....:||.::..|.|.:..||...:.:..:..||:||:..|..
pombe   122 AMDLFDIVDKNSASANRSKQADQRQLKTKADYAAFQADILKKVKNCQTTAEYNNFVQDLIPLLLT 186

  Fly   170 NLSAADIKKVKMNVEILHSEKLKLEKANAKK--------------PAGKGKGKVTLRTEND---- 216
            .|:|.::|.|:.:|..|...|.:.||..:|:              |:.|| ||.|:...:.    
pombe   187 GLNATNLKAVQKSVNKLVVNKEQQEKTQSKRGAAAPAAKPVSTAAPSKKG-GKPTVNVNSKKTVA 250

  Fly   217 DIDGYQKY----GNDFTEDYDDFM 236
            |...|:.|    .:|:.:|:||||
pombe   251 DKSAYEDYIEDEYDDYADDFDDFM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3jNP_001286260.1 eIF3_subunit 3..236 CDD:285763 66/282 (23%)
SPAC3A12.13cNP_593339.1 eIF3_subunit <74..257 CDD:285763 45/189 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4813
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55542
OrthoFinder 1 1.000 - - FOG0004066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103515
Panther 1 1.100 - - LDO PTHR21681
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.