DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3j and eif-3.J

DIOPT Version :9

Sequence 1:NP_001286260.1 Gene:eIF3j / 36037 FlyBaseID:FBgn0027619 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_493365.1 Gene:eif-3.J / 173213 WormBaseID:WBGene00012738 Length:212 Species:Caenorhabditis elegans


Alignment Length:238 Identity:61/238 - (25%)
Similarity:99/238 - (41%) Gaps:51/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VNKWEGEDEDEDIKDSWEDEEEKK-----DEEKPTKTEAPAKPKPNKALKAKLEQQALLEEEAEA 82
            ::.||.:|.:.::......|...:     |...|.:..|||.||..||... ...::|..|    
 Worm     1 MSDWEDDDFEPEVSTFKRAEPAPEPVKIVDAPPPPQKAAPAAPKTLKAAPT-FAMESLGRE---- 60

  Fly    83 KRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTSTCGGLDAFNPETKEEFKEFGATLS--- 144
                 |:.|||       :.||:.:||..|::.||        |..:.|..:|.|.:...:|   
 Worm    61 -----LTSAEK-------EAIQKKNDLALARDLFG--------DDDSAEATDEAKTYANIMSKAD 105

  Fly   145 ---W--KVGQFRESEH----FPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEKANAK- 199
               |  :||.|..|..    :...:..|:.|:...::.|:|.|:...::.:.:.|...||..|| 
 Worm   106 FEYWGERVGGFLASRSKASCYGDMIGKLLTSVTDEMTPAEILKMVTFLQQISAAKKTAEKTKAKA 170

  Fly   200 ----KP---AGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDF 235
                ||   |.|...|.||:....:...|..||:| .:||||:
 Worm   171 TTAAKPAAAANKKNAKATLKVTKGNDSMYDDYGDD-QDDYDDY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3jNP_001286260.1 eIF3_subunit 3..236 CDD:285763 61/238 (26%)
eif-3.JNP_493365.1 eIF3_subunit 1..>151 CDD:285763 41/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4813
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21681
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.