DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3j and Eif3j2

DIOPT Version :9

Sequence 1:NP_001286260.1 Gene:eIF3j / 36037 FlyBaseID:FBgn0027619 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001242984.1 Gene:Eif3j2 / 100042807 MGIID:3704486 Length:263 Species:Mus musculus


Alignment Length:249 Identity:100/249 - (40%)
Similarity:149/249 - (59%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADDWESAADS-EVVIRPTA---AASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEA--PAKP 60
            :|.|::...| |..:|..|   .|..::|||||||||:||:|:|::::..||...|.|.  ..|.
Mouse    16 SDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKK 80

  Fly    61 KPNKALKAKLEQQALLEEEAEAKRLAN------LSPAEKLAEKLRLQKIQEASDLKHAQEAFGVT 119
            |..:.:|.|..||...:||.: |||..      |:|.|:||:||||:|:||.|||:.|:|.|||.
Mouse    81 KIAEKIKEKERQQKKRQEEIK-KRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVN 144

  Fly   120 STCGGLDAFNPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVE 184
            :|..|:||.||.::::|.|||..|..|:.|:.:|.::..|:|.|||.:|::|...|:||:..::.
Mouse   145 NTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLT 209

  Fly   185 ILHSEKLKLEKANAKKPAGKG--KGKVTLRTENDDIDGYQKYGNDFTEDYDDFM 236
            :|.|||.|.||.:..|...||  .|.....|..||:..|..|...:.:||:|||
Mouse   210 VLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGYVQDYEDFM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3jNP_001286260.1 eIF3_subunit 3..236 CDD:285763 98/246 (40%)
Eif3j2NP_001242984.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 36/99 (36%)
Sufficient for interaction with EIF3B. /evidence=ECO:0000255|HAMAP-Rule:MF_03009 6..74 23/57 (40%)
eIF3_subunit 17..263 CDD:285763 98/246 (40%)
Promotes stable association with the 40S ribosome. /evidence=ECO:0000255|HAMAP-Rule:MF_03009 248..263 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849122
Domainoid 1 1.000 172 1.000 Domainoid score I3710
eggNOG 1 0.900 - - E1_KOG4813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37845
Inparanoid 1 1.050 173 1.000 Inparanoid score I4071
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55542
OrthoDB 1 1.010 - - D1565510at2759
OrthoFinder 1 1.000 - - FOG0004066
OrthoInspector 1 1.000 - - otm43556
orthoMCL 1 0.900 - - OOG6_103515
Panther 1 1.100 - - LDO PTHR21681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4553
SonicParanoid 1 1.000 - - X5085
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.