DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG34409

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:334 Identity:92/334 - (27%)
Similarity:137/334 - (41%) Gaps:99/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PFAHELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRP 90
            |||.|                  :::.||.: ..|.::||.:|.:.||||...:.|. ..:..|.
  Fly   233 PFAQE------------------NTQGCGIN-VESRLLGGDQASAGQFPWLTRIAYR-NRSSSRI 277

  Fly    91 SPMCAGSLIASRYVLTAAHCL--NVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDV 153
            |..|:||||:|.:::|||||:  .|:|..::.||||..|            ||..:|       :
  Fly   278 SFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLGSQD------------GATPFA-------I 323

  Fly   154 DLRVPHEQYYTRNGRHYNDIALLRLKS-RVKYTLQIRPICIWPGIELSTSSFKNFPF-------- 209
            :..:.|..|  ...::.|||||||:.| ...:|    |||:              ||        
  Fly   324 EQVIVHPNY--DQPKYANDIALLRINSTNGTFT----PICL--------------PFNGPITLGN 368

  Fly   210 ----QI---AGWGDSGLQQKSTVLRQGTISG--------MSPDECLNRYPTL-------LVDKDI 252
                ||   |||.....:..|::....:.:|        ::...|...|.:|       :|....
  Fly   369 RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPN 433

  Fly   253 QICAMGWDGTDTGLGDSGSPLM---ASVGRGADQFYYLAGITSYGGGPSSYGYG--PAVYTKTSS 312
            .:||.|....|...||||.|.|   .|...|....|.:.||.::  ||:..|..  |.|||..||
  Fly   434 HLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAF--GPTLCGVTTIPGVYTLVSS 496

  Fly   313 YYEWIKKKI 321
            :.:||.:.|
  Fly   497 FSDWILRSI 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/295 (28%)
Tryp_SPc 62..317 CDD:214473 82/292 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 82/293 (28%)
Tryp_SPc 252..501 CDD:238113 82/290 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.