DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:328 Identity:94/328 - (28%)
Similarity:129/328 - (39%) Gaps:102/328 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LCNINPFAHELVHMVFTCCPM--------VAGDKLPDSRVC--GQSPPSSYIVGGMEAQSNQFPW 75
            :|:.....|.|||      |.        :.| ::.:..:.  ||.|   ||| |:...||...|
  Fly    14 VCSALTVPHSLVH------PRDLEIRHGGIEG-RITNGNLASEGQVP---YIV-GVSLNSNGNWW 67

  Fly    76 TVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVND---FYVARVRLGE----H--DTEND 131
                             .|.||:|...:|||||||....|   .|...|...|    |  .:||.
  Fly    68 -----------------WCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENF 115

  Fly   132 PDYTWLPNGAKIWAPAHVDIDVDL---RVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICI 193
            ..|           |.:|.:|.||   :.||..:|:.    .|.|.|                  
  Fly   116 IRY-----------PHYVGLDHDLALIKTPHVDFYSL----VNKIEL------------------ 147

  Fly   194 WPGIELSTSSFKNFPFQIAGWGDSGLQQKSTV---LRQGTISGMSPDECLNRYPTLLVDKDIQIC 255
             |.::...:|::|...|.||||  .:...|.|   ||...:..:|..||...|.|....:: .||
  Fly   148 -PSLDDRYNSYENNWVQAAGWG--AIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASEN-TIC 208

  Fly   256 AMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGY---GPAVYTKTSSYYEWI 317
            ....||..|..||||.||:...|   |:   |.||||:   .|:||.   |||.:|:.:.|.|||
  Fly   209 VETPDGKATCQGDSGGPLVTKEG---DK---LIGITSF---VSAYGCQVGGPAGFTRVTKYLEWI 264

  Fly   318 KKK 320
            |::
  Fly   265 KEE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 83/275 (30%)
Tryp_SPc 62..317 CDD:214473 80/272 (29%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 84/290 (29%)
Tryp_SPc 41..266 CDD:238113 86/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.