DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:106/282 - (37%) Gaps:105/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GYEAYTAK----------QRPSPMCAGSLIASRYVLTAAHCLN----VNDFYVARVRLGEHDTEN 130
            ||.||..|          ...:..|.||:|.:.:|||||||.|    |...|.|.:|       .
  Fly    39 GYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIR-------T 96

  Fly   131 DPDYT-WLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLR--------LKSRVK--- 183
            .|.|| |:.:|         ||     :.|..|  .:|..:|||:|:|        |.::|:   
  Fly    97 QPQYTHWVGSG---------DI-----IQHHHY--NSGNLHNDISLIRTPHVDFWSLVNKVELPS 145

  Fly   184 YTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLV 248
            |..:.:....|..:             .:|||             ||..| ||      .|..|.
  Fly   146 YNDRYQDYAGWWAV-------------ASGWG-------------GTYDG-SP------LPDWLQ 177

  Fly   249 DKDIQI-----CAMGWD--------GTDTGL----GDSGSPLMASVGRGADQFYYLAGITSYGGG 296
            ..|:||     |:..|.        .||.|.    ||||.||:...|.      .|.|:||:|..
  Fly   178 SVDVQIISQSDCSRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGN------RLVGVTSFGSA 236

  Fly   297 PSSYGYGPAVYTKTSSYYEWIK 318
            .......|||:::.:.|.:||:
  Fly   237 AGCQSGAPAVFSRVTGYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 76/282 (27%)
Tryp_SPc 62..317 CDD:214473 74/279 (27%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 76/282 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.