DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG11842

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:284 Identity:84/284 - (29%)
Similarity:120/284 - (42%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSY---IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVAR 120
            :||   |:||..|...:||....||::....:  ....|.|:||:.|:|||||||.......|..
  Fly    67 TSYAPLIIGGGPAVPKEFPHAARLGHKDENGE--VEWFCGGTLISDRHVLTAAHCHYSPQGSVNI 129

  Fly   121 VRLG--EHDTEN---DPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQY-YTRNGRHYNDIALLRLK 179
            .|||  |.||.|   ||:                |.||.....|.:: |.   ..||||:::||.
  Fly   130 ARLGDLEFDTNNDDADPE----------------DFDVKDFTAHPEFSYP---AIYNDISVVRLS 175

  Fly   180 SRVKYTLQIRPICI-WPGIELSTSSFKNFPFQIAGWG--------DSGLQQKSTVLRQGT---IS 232
            ..|.:.....|.|: :....|.||      |...|||        ::...||..:...||   |:
  Fly   176 RPVTFNDYKHPACLPFDDGRLGTS------FIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRIT 234

  Fly   233 GMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGP 297
            ....||....|     :...|:|....:..||..||||.|::. ........|::.||||.|...
  Fly   235 ADRNDELPEGY-----NATTQLCIGSNEHKDTCNGDSGGPVLI-YHMDYPCMYHVMGITSIGVAC 293

  Fly   298 SSYGYGPAVYTKTSSYYEWIKKKI 321
            .:... ||:||:...|.:|||:::
  Fly   294 DTPDL-PAMYTRVHFYLDWIKQQL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 82/275 (30%)
Tryp_SPc 62..317 CDD:214473 79/272 (29%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 82/275 (30%)
Tryp_SPc 73..312 CDD:214473 79/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.