DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG11841

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:332 Identity:93/332 - (28%)
Similarity:132/332 - (39%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NINPFA--------------HELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQF 73
            |.:|||              ...:...||..|:..  :..||  |..|.|  .||.|..|:..:|
  Fly    25 NPDPFAQLACTKFKQIVFEERVAISFFFTDAPITY--ETVDS--CHGSRP--LIVDGTPAEPKEF 83

  Fly    74 PWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLP 138
            |:...||:.  .........|.|:||::|.|||||||.......|..|||||.:.:.|.|.....
  Fly    84 PFAARLGHR--KTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPE 146

  Fly   139 NGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSS 203
            :...:...||...:             |.:.||||.:::|...||:.....|.|:          
  Fly   147 DFGVLALKAHPGFE-------------NPQLYNDIGIVQLDREVKFNRYKHPACL---------- 188

  Fly   204 FKNFPFQ--------IA-GWGDSGLQQKST-----VLRQG----TISGM-SPDECLNRYPTLLVD 249
                ||.        || |||.....||.:     |..||    .:|.: :.||..|.|     :
  Fly   189 ----PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGY-----E 244

  Fly   250 KDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYY 314
            ...|:|....|..||..||||.|::| ..:.....|::.||||.|...|:... |:.||:...:.
  Fly   245 PKSQLCIGSRDNKDTCNGDSGGPVLA-YHKDLACMYHVMGITSAGITCSTPDI-PSAYTRVHYFL 307

  Fly   315 EWIKKKI 321
            .|||.::
  Fly   308 NWIKGEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 81/276 (29%)
Tryp_SPc 62..317 CDD:214473 78/273 (29%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 79/274 (29%)
Tryp_SPc 72..310 CDD:214473 78/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.