DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG4815

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:61/269 - (22%)
Similarity:104/269 - (38%) Gaps:106/269 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MCAGSLIASRYVLTAAHC---LNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVD 154
            :|:.:|:..|::||||||   ||.:.|:|    :|....|    :||                  
  Fly    60 VCSATLLTPRHILTAAHCFENLNRSKFHV----IGGKSAE----FTW------------------ 98

  Fly   155 LRVPHEQYYTRNGRHYNDIALLRLK----------------SRVKYTLQIR-----PIC---IWP 195
                       :|.::|...|:|::                ::.||.|:.:     .:|   :.|
  Fly    99 -----------HGNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHP 152

  Fly   196 GIELSTSSFKNFPFQIAGWGDSG----LQQKSTV--LRQGTISGMSPDECLNRY--PTLLVDKDI 252
            ..:|..          ||||..|    ..:|.|.  ::.|.:|....::.|:|.  |.:      
  Fly   153 RDKLIA----------AGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNI------ 201

  Fly   253 QICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG----PAVYTKTSSY 313
             |||..::......||||.||:  :||      .:.||.::     ::..|    |.||.....|
  Fly   202 -ICAGAYNNKTLCFGDSGGPLL--LGR------QVCGINTW-----TFKCGNNEKPDVYMGVRYY 252

  Fly   314 YEWIKKKIN 322
            .::||:.||
  Fly   253 AKFIKRTIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 59/265 (22%)
Tryp_SPc 62..317 CDD:214473 57/262 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/265 (22%)
Trypsin 49..256 CDD:278516 57/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.