DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG10232

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:338 Identity:132/338 - (39%)
Similarity:173/338 - (51%) Gaps:47/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KILHPRNMT-NDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGG 65
            |.|...|.| .|..:...|:.|.|:....:.....:.||| ..|:.||.|  |||:||...:..|
  Fly   199 KCLRIHNTTMEDGANLMDNRQCAIDTRRIDSDKRHYICCP-EPGNVLPTS--CGQAPPLYRMAYG 260

  Fly    66 MEAQSNQFPWTVLLGYEAYTAKQRPSPM---CAGSLIASRYVLTAAHCL----NVN-DFYVARVR 122
            ..|:.|::||..:|.||    .:|.|.|   |:||||..|||||||||:    .|| |..:.|||
  Fly   261 TAARPNEYPWMAMLIYE----NRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVR 321

  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQ 187
            |||||...:||..:..|.|   || .|:|.::....||||: ...|..:||||:||::.|:||.:
  Fly   322 LGEHDITTNPDCDFTGNCA---AP-FVEIGIEYFNVHEQYF-NTSRFESDIALVRLQTPVRYTHE 381

  Fly   188 IRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDK-- 250
            |.|||    :........|.|.||||||.:..::.|.||...|:..       |||  ...||  
  Fly   382 ILPIC----VPKDPIPLHNHPLQIAGWGYTKNREYSQVLLHNTVYE-------NRY--YCQDKIS 433

  Fly   251 ----DIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG---PAVYT 308
                :.||||.|..|.|:..||||.|||.::........|||||.|||    |...|   |.|||
  Fly   434 FFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYG----SENCGDRKPGVYT 494

  Fly   309 KTSSYYEWIKKKI 321
            ||.:::.|||..:
  Fly   495 KTGAFFSWIKANL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 112/274 (41%)
Tryp_SPc 62..317 CDD:214473 109/271 (40%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 112/271 (41%)
Tryp_SPc 260..503 CDD:214473 109/268 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463192
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.