DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31199

DIOPT Version :10

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:47 Identity:15/47 - (31%)
Similarity:21/47 - (44%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PHKEYGVPVQSYGPPNVNIEY-------GPPPAPVP----KPVYHPH 157
            ||.:|||.:.::......:.|       |..|||:.    ||.| ||
  Fly   464 PHDDYGVRLLAFNEQCNEMRYARQCLASGSEPAPLRELRYKPCY-PH 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..317 CDD:214473 15/47 (32%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.