DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31219

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:294 Identity:119/294 - (40%)
Similarity:158/294 - (53%) Gaps:32/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASR 102
            ||| ..|::||.:.:||||..:..:|||.||:.|.:||..:|.| ..|......|.||||||.:|
  Fly    66 CCP-PPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLY-LNTTTLEILPFCAGSLINNR 128

  Fly   103 YVLTAAHCLN--VNDFYVARVRLGEHDTENDPDYT----------WLPNGAKIWAPAHVDIDVDL 155
            ||||:|||:|  ..|..:..|||||||...||.|.          .|||         ::|.::.
  Fly   129 YVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPN---------LEIKLEK 184

  Fly   156 RVPHEQYYTRNGRHYN-DIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGL 219
            .:.|..:.:.:.|:.. ||||||||..|:|...|.|||| |    ....|.....:|||||.:..
  Fly   185 IIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI-P----KHGFFAKSKLEIAGWGKTNE 244

  Fly   220 QQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQF 284
            .|.|.||..|.|...|...|..|:|.|.:::.:||||.|:||.||..||||.|||.::...:   
  Fly   245 GQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSS--- 306

  Fly   285 YYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            .||||||:||.........|.:||:||::..|||
  Fly   307 VYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 109/270 (40%)
Tryp_SPc 62..317 CDD:214473 106/267 (40%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 106/268 (40%)
Tryp_SPc 90..342 CDD:238113 109/269 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463191
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.