DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG4053

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:304 Identity:78/304 - (25%)
Similarity:121/304 - (39%) Gaps:107/304 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLG--YEAYTAKQRPSPMCAGSLIASRYVLTAA 108
            ||.|:|          ||||.||:....|:.|.:.  ::.:        :|:|.::..:::|||.
  Fly    29 KLLDNR----------IVGGQEAEDGVAPYQVSIQTIWKTH--------ICSGVILNEQWILTAG 75

  Fly   109 HCLNVNDFYV--ARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYN 171
            ||  ..||.:  .|:.:|.:| ..:|..|..|:.|.:    |...|:.        |..|    |
  Fly    76 HC--ALDFSIEDLRIIVGTND-RLEPGQTLFPDEALV----HCLYDIP--------YVYN----N 121

  Fly   172 DIALLRLKSRVKYT--LQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGM 234
            ||||:.:...:.:.  .||        :|||...      ..||         |||    |::|.
  Fly   122 DIALIHVNESIIFNDRTQI--------VELSREQ------PPAG---------STV----TLTGW 159

  Fly   235 SPDECLNRYPTLLVDKDIQI-------CAMGW---DGTDTG-------------LGDSGSPLMAS 276
            ...|  :.|||:...:.:.:       |...|   ||.|.|             .||||.|||..
  Fly   160 GAPE--SSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWE 222

  Fly   277 VGRGADQFYYLAGITSYGGGPSSYGYG-PAVYTKTSSYYEWIKK 319
             |:       |.|:.::|   .:.|.| |.:|..|..|.:||::
  Fly   223 -GK-------LVGLVNWG---RACGVGMPDMYANTVYYQDWIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 74/288 (26%)
Tryp_SPc 62..317 CDD:214473 72/284 (25%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 73/295 (25%)
Tryp_SPc 35..256 CDD:238113 74/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.