DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG17475

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:278 Identity:71/278 - (25%)
Similarity:107/278 - (38%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLG--YEAYTAKQRPSPMCAGSLIASRYVLTAAHCL-NVNDFYVARVRL 123
            ::.|.:.|..:..:.:.|.  |..:        :|.|.:|..|:|||||||: ..|..|: ||..
  Fly    50 VINGEDVQLGEAKYQISLQGMYGGH--------ICGGCIIDERHVLTAAHCVYGYNPTYL-RVIT 105

  Fly   124 GEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQI 188
            |..:.|. ||..:.               |:....|..|.:.:  ::|||||:||...:|:....
  Fly   106 GTVEYEK-PDAVYF---------------VEEHWIHCNYNSPD--YHNDIALIRLNDTIKFNEYT 152

  Fly   189 RPICIWPGIELSTSSFKN-FPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDI 252
            :|      .||.|:...| ....:.|||.:.|.            |.:||.....|.|.:|....
  Fly   153 QP------AELPTAPVANGTQLLLTGWGSTELW------------GDTPDILQKAYLTHVVYSTC 199

  Fly   253 Q-------------ICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGP 304
            |             ||.:...|.....||||.||   ...|.     |.|:.:: |.|.:.|. |
  Fly   200 QEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL---THNGV-----LYGLVNW-GYPCALGV-P 254

  Fly   305 AVYTKTSSYYEWIKKKIN 322
            ..:.....|.|||:..|:
  Fly   255 DSHANVYYYLEWIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/274 (26%)
Tryp_SPc 62..317 CDD:214473 68/271 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/271 (25%)
Tryp_SPc 50..269 CDD:238113 70/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.