DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31265

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:296 Identity:74/296 - (25%)
Similarity:113/296 - (38%) Gaps:84/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVCGQSP--PSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRP---SPMCAGSLIASRYVLTAAHC 110
            |:.|..|  .|..|.||.||:         :|:..|....:|   |..|.|:::...:::||.||
  Fly    24 RIVGPFPAGQSGRIKGGEEAE---------IGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHC 79

  Fly   111 LNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRN-GRH----- 169
              |.:|..|.|.              :..|...||.           |...|||.. .:|     
  Fly    80 --VENFIPALVN--------------VITGTNKWAE-----------PGAIYYTAEIHKHCMYDQ 117

  Fly   170 ---YNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQ------IAGWG-DSGLQQKST 224
               :|||||::|...:.:....:||.:           ...|.|      :.||| |........
  Fly   118 PYMHNDIALVKLTENITFNELTQPIAL-----------PTRPVQLGEEIVLTGWGSDVAYGSSME 171

  Fly   225 VLRQGTISGMSPDEC---LNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYY 286
            .|.:.|:..:..|||   .||..::.|.   .||....:|.....||||.||::: |:       
  Fly   172 DLHKLTVGLVPLDECYETFNRTSSMGVG---HICTFSREGEGACHGDSGGPLVSN-GQ------- 225

  Fly   287 LAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKIN 322
            |.|:.:: |.|...|. |.|......|.:||:.|::
  Fly   226 LVGVVNW-GRPCGVGL-PDVQANVYYYLDWIRSKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/279 (25%)
Tryp_SPc 62..317 CDD:214473 67/276 (24%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 67/277 (24%)
Tryp_SPc 39..257 CDD:238113 68/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.