DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and modSP

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:363 Identity:83/363 - (22%)
Similarity:120/363 - (33%) Gaps:86/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YRNK-LCNIN--------PFAHELVHMVFTCCPMVAGDK----LPDSRV---------------- 52
            |..| ||..|        ||......:.|.|.   .|.|    ||:.|.                
  Fly   296 YSTKALCTHNGQQVECRKPFHPPGTEVKFVCS---TGFKTLSPLPEMRCMKGGYWNRGRQRCEQD 357

  Fly    53 CGQ--SPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVND 115
            |||  :|...:..||....:...||.|  |...:..::.....|.|||:....|:|||||:    
  Fly   358 CGQLATPIKQFSSGGYTINNTVVPWHV--GLYVWHNEKDYHFQCGGSLLTPDLVITAAHCV---- 416

  Fly   116 FYVARVRLG-EHDTENDPDYTWLPNGAKIW------APAHVDIDVDLRVPHEQYYTRNGRHYNDI 173
             |....||. .:|       |:....||.:      .|.....||.|......|..|...:|.|:
  Fly   417 -YDEGTRLPYSYD-------TFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDL 473

  Fly   174 ALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNF----------PFQIAGWGDSGLQQKSTVLRQ 228
            |||.|....:.:..|||||:         :|.:|          ..:.|||   .::.|..:...
  Fly   474 ALLTLDEPFELSHVIRPICV---------TFASFAEKESVTDDVQGKFAGW---NIENKHELQFV 526

  Fly   229 GTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGA-----DQFYYLA 288
            ..:| .|...|......:..||   .|......:....||||....:.:...|     ...::|.
  Fly   527 PAVS-KSNSVCRRNLRDIQADK---FCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLF 587

  Fly   289 GITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKINDIAE 326
            |:.|.........:...|.|....:.:.|...:|...|
  Fly   588 GVISNAPNADQCAHSLTVMTNIQHFEDMILNAMNRSVE 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 63/279 (23%)
Tryp_SPc 62..317 CDD:214473 62/276 (22%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512 9/47 (19%)
Tryp_SPc 371..616 CDD:214473 62/274 (23%)
Tryp_SPc 371..591 CDD:304450 59/249 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.