DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31326

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:292 Identity:82/292 - (28%)
Similarity:126/292 - (43%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGQSPPSS--YIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNV-- 113
            ||:...|:  .|..|...|..|.||.|.: :|. .....|:.:|.|:||::..||:||||...  
  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAI-FER-RESNGPAFICGGTLISTSTVLSAAHCFRAPG 325

  Fly   114 NDFYVAR--VRLGEHD--TENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIA 174
            .|...:|  |.||.:.  ..:|.::.                .|...:.||.:..:.... .|:|
  Fly   326 RDLPASRLAVSLGRNTLAIHSDGEFR----------------GVSQLIIHENFQFKQFTE-ADLA 373

  Fly   175 LLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFP----FQIAGWGDSGLQQKSTVLRQGT-ISGM 234
            |:||...|:||..|.|||:|     |||:..:.|    ..:||||.......:|.:.:.| ::.:
  Fly   374 LVRLDEPVRYTDYIVPICLW-----STSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIV 433

  Fly   235 SPDECLNRYPTLLVDKDIQICAMGWDGTDTGLG----DSGSPLMASVGRGADQFYYLAGITSYGG 295
            |...|....|.:||... .:||     ..||.|    |.|.|||.   |..| .:.|.|:.|  |
  Fly   434 SEANCALELPHVLVQPS-SLCA-----KKTGAGPCASDGGGPLML---REQD-VWVLRGVIS--G 486

  Fly   296 GPSSYGYG------PAVYTKTSSYYEWIKKKI 321
            |..:....      |:|:|..:.:.||:::|:
  Fly   487 GVINEKENTCELSKPSVFTDVAKHIEWVRQKM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 78/278 (28%)
Tryp_SPc 62..317 CDD:214473 77/275 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 77/275 (28%)
Tryp_SPc 277..514 CDD:214473 76/272 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.