DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG9649

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:339 Identity:84/339 - (24%)
Similarity:132/339 - (38%) Gaps:87/339 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LHPRNMTNDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCG-----QSPPSSYIV 63
            :||.| |..|.|::                     .|...|..   |.:||     |:|   :|.
  Fly   222 VHPSN-TPAQASKF---------------------YPQTIGQL---SGICGREKVIQTP---FIH 258

  Fly    64 GGMEAQSNQFPWTVLL------GYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVR 122
            .|:|.:..|.||...|      .|..         :|.|:||::|.|::||||.          |
  Fly   259 NGIEVERGQLPWMAALFEHVGRDYNF---------LCGGTLISARTVISAAHCF----------R 304

  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYN--DIALLRLKSRVKYT 185
            .|..:...:.....|...:.....:...:.|...:.||||   |...|.  |:|||:|.:.|...
  Fly   305 FGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQY---NPNVYTDADLALLQLSNHVDIG 366

  Fly   186 LQIRPICIWPG---IELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPD-ECLNRYPTL 246
            ..|:|||:|..   :|| .|..|::   :||||:.....::|.|.:.|.:.:... ||...    
  Fly   367 DYIKPICLWNENFLLEL-PSGHKSY---VAGWGEDEKGNRNTRLAKMTDTDIITQWECRGN---- 423

  Fly   247 LVDKDIQ------ICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYG--YG 303
            |.:::.:      |||.....:....||||..||..    ....:.|.|:.|.|...::..  ..
  Fly   424 LSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQ----EQDIWMLRGVVSAGQRMTNRCNLTL 484

  Fly   304 PAVYTKTSSYYEWI 317
            |.:||..:.:.||:
  Fly   485 PVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 71/276 (26%)
Tryp_SPc 62..317 CDD:214473 70/274 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 70/274 (26%)
Tryp_SPc 259..497 CDD:214473 68/271 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.