DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG8870

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:342 Identity:133/342 - (38%)
Similarity:171/342 - (50%) Gaps:37/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PRN---MTNDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCGQS--PPSSYIVGG 65
            ||.   |.:.:|:....:.|..|.          .|||... ..||.. .||||  .|:.    |
  Fly    39 PRTRAVMNSSRKNIIGLRRCGTNK----------VCCPKWE-TYLPHD-TCGQSRRKPTK----G 87

  Fly    66 MEAQSNQFPWTVLLGY-EAYTAKQRPSPMCAGSLIASRYVLTAAHCLNV----NDFYVARVRLGE 125
            .....|:|||..:|.| ......|:..|.|.||||.:.||||||||:..    ..:.:..|||||
  Fly    88 KIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGE 152

  Fly   126 HDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRP 190
            |:|..:||.. :.||.:.:||.:::|:||..:.||| :.|..|..|||||:|||..|:||..|:|
  Fly   153 HNTSTNPDRA-IVNGRRQYAPLYMEIEVDQIITHEQ-FNRGRRLINDIALVRLKFPVRYTRAIQP 215

  Fly   191 ICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQIC 255
            ||:....:|:....|   ||.:||.|.|....|.||.:..|:...||.|.:.|...|   ..|||
  Fly   216 ICLPRAQKLAAHKRK---FQASGWPDMGQGIASEVLLRSFIAERHPDVCKSNYDFNL---GSQIC 274

  Fly   256 AMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSY-GYGPAVYTKTSSYYEWIKK 319
            |.|.||.||..||||.|||.:|.||.....|.|||.|||..|... ...||.|||||.::||||.
  Fly   275 AGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKS 339

  Fly   320 KIND--IAEDERKMKYK 334
            |:..  |..|.:....|
  Fly   340 KLQSPFIDSDSKSRTRK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 113/263 (43%)
Tryp_SPc 62..317 CDD:214473 110/260 (42%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 112/254 (44%)
Tryp_SPc 93..337 CDD:214473 109/251 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D88822at6656
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.