DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Sp7

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:287 Identity:91/287 - (31%)
Similarity:136/287 - (47%) Gaps:25/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAA 108
            |:.||....||....|:.:..|.:...::|.|..||.|.....::..|  |.||||.:|||||||
  Fly   119 GNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELS--CGGSLINNRYVLTAA 181

  Fly   109 HC----LNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRH 169
            ||    :.....::..|||||:||..|.|..     ..|.....:.:.::....|.||...|...
  Fly   182 HCVIGAVETEVGHLTTVRLGEYDTSKDVDCI-----DDICNQPILQLGIEQATVHPQYDPANKNR 241

  Fly   170 YNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGM 234
            .:|||||||...|.....|:|:|: |.:....:........::|||.:...:|||:.::..:...
  Fly   242 IHDIALLRLDRPVVLNEYIQPVCL-PLVSTRMAINTGELLVVSGWGRTTTARKSTIKQRLDLPVN 305

  Fly   235 SPDECLNRYPTLLVDKDI-----QICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYG 294
            ..|.|..::.|    ::|     |:|..|....|:..||||.|||.   ||.||.:|..|:.|:|
  Fly   306 DHDYCARKFAT----RNIHLISSQLCVGGEFYRDSCDGDSGGPLMR---RGFDQAWYQEGVVSFG 363

  Fly   295 GGPSSYGYGPAVYTKTSSYYEWIKKKI 321
            ......|: |.|||:.:.|.:||.:.|
  Fly   364 NRCGLEGW-PGVYTRVADYMDWIVETI 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/266 (32%)
Tryp_SPc 62..317 CDD:214473 82/263 (31%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 82/264 (31%)
Tryp_SPc 137..388 CDD:238113 84/266 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.