DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and MP1

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:289 Identity:102/289 - (35%)
Similarity:146/289 - (50%) Gaps:19/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AGDK-LPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPM----CAGSLIASR 102
            :|.| ||.:..||:: ....:|||.|....:|||..|:.|      .:|..:    |.||||..|
  Fly   119 SGTKLLPMAPNCGEN-FGDRVVGGNETTKREFPWMALIEY------TKPGNVKGHHCGGSLINHR 176

  Fly   103 YVLTAAHCLNV--NDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTR 165
            ||||||||::.  :|:.:..|||||.|...:||.|...||.:.....:||..|:.|:||.||...
  Fly   177 YVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN 241

  Fly   166 NGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGT 230
            :....||||||||:..|:|:..|.|:|:........:.|......:||||.:.....|.:..:..
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAE 306

  Fly   231 ISGMSPDECLNRYPT---LLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITS 292
            :..:...||..||.|   .:..|  |:||.|.:|.|:..||||.||:.......:..||:||:.|
  Fly   307 LDTVPTSECNQRYATQRRTVTTK--QMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVS 369

  Fly   293 YGGGPSSYGYGPAVYTKTSSYYEWIKKKI 321
            ||..|......|.|||:..:|..||:..:
  Fly   370 YGPTPCGLKGWPGVYTRVEAYLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 96/266 (36%)
Tryp_SPc 62..317 CDD:214473 94/263 (36%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 94/264 (36%)
Tryp_SPc 138..397 CDD:238113 96/266 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463205
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.