DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG18223

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:271 Identity:57/271 - (21%)
Similarity:111/271 - (40%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VLLGYEAYTAKQRPSPM------CAGSLIASRYVLTAAHCLNVNDFYV--ARVRLGEHDTENDPD 133
            ||..|......:||..:      |.|.:|:..|:||:|||.......|  :||.:....|.|   
  Fly    56 VLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTN--- 117

  Fly   134 YTWLPNGAKIWAPAHVDIDVDLR---VPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWP 195
                    ::.:...:.::::::   || :::...|   .|:|||:.|..::.....:..:    
  Fly   118 --------RLKSRKGLSLNMEVKKIFVP-DKFTVFN---TNNIALMMLAKKLPLDNPLVGV---- 166

  Fly   196 GIELSTSSFK-NFPFQIAGWGDSGLQQKSTVLRQGTISG---------MSPDECLNRYPTLLVDK 250
             |.|.|:..: ...:.:.|||        .:.:.|.::.         :..|.|..:   :.:.|
  Fly   167 -INLPTADPEPGLNYTVLGWG--------RIFKGGPLASDILHIDVELLPRDICEKK---VHIFK 219

  Fly   251 DIQICAMGWDGT---DTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSS 312
            :..:||...:.|   :...||:||||:.:        ..:.|:.||..|..|... |::||....
  Fly   220 EEMMCAGNLNNTMDENPCAGDTGSPLIFN--------ETVFGVVSYRVGCGSKTL-PSIYTNVYM 275

  Fly   313 YYEWIKKKIND 323
            :.:||...:|:
  Fly   276 HMDWINGIMNN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 56/266 (21%)
Tryp_SPc 62..317 CDD:214473 54/263 (21%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 54/262 (21%)
Tryp_SPc 60..280 CDD:214473 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.