DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG7542

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:118/297 - (39%) Gaps:43/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MVFTCCPMVAGDKLPDSRVCGQSP----PSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMC 94
            |....|.::.|.       |...|    ...||..|..|:..|||:...|.    .:....|..|
  Fly     2 MKLLVCVLLVGS-------CTAVPLLTDVEPYITNGEPAEVGQFPYQAGLN----VSFGNWSTWC 55

  Fly    95 AGSLIASRYVLTAAHCLNVND---FYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLR 156
            .|:||:..:::|||||::..:   .|:..:.:|:...|..               ..:.::....
  Fly    56 GGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQ---------------ERIMVEKSGI 105

  Fly   157 VPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWG--DSGL 219
            :.|..|..  ....|||:|:||.:.|.:|.:||...:...:.....::::.....:|||  ....
  Fly   106 IVHSNYMA--STVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDAS 168

  Fly   220 QQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQF 284
            ...|.|||...:..|....|...:...:.:|  .||.....|..|..||||.||:...|..:   
  Fly   169 DSVSPVLRYVEMPIMPHSLCRMYWSGAVSEK--MICMSTTSGKSTCHGDSGGPLVYKQGNSS--- 228

  Fly   285 YYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKI 321
             ||.|.||:|.........|||:|:.|||.:||...|
  Fly   229 -YLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 68/262 (26%)
Tryp_SPc 62..317 CDD:214473 66/259 (25%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 68/262 (26%)
Tryp_SPc 27..260 CDD:214473 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.