DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG18179

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:257 Identity:68/257 - (26%)
Similarity:105/257 - (40%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126
            ||.|..|...:.|:  ::|....|.....:.:.||::|||.::|||||||..:  || .:..|.:
  Fly    40 IVNGYPAPEGKAPY--IVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD--YV-EIHYGSN 99

  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191
                     |..|||     ....:..|..:.|..:....||   ||.|:|..| |.:|..|..:
  Fly   100 ---------WGWNGA-----FRQSVRRDNFISHPNWPAEGGR---DIGLIRTPS-VGFTDLINKV 146

  Fly   192 CIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICA 256
            .: |.....:..|.:......|||.......:..|:...:..:|..||...|.|:   ....:|.
  Fly   147 AL-PSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTV---ASTDMCT 207

  Fly   257 MGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            ...||..:..||||.||:.....      .|.|:.::|.  .....||:.||:.:.|..||:
  Fly   208 RRTDGKSSCGGDSGGPLVTHDNA------RLVGVITFGS--VDCHSGPSGYTRVTDYLGWIR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 68/257 (26%)
Tryp_SPc 62..317 CDD:214473 66/254 (26%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/254 (26%)
Tryp_SPc 40..263 CDD:238113 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.