DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG3088

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:288 Identity:66/288 - (22%)
Similarity:120/288 - (41%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVL 105
            :.||....||     ..|...|..|..|...|.|:.|.:.:      .:.:..|:|::|...::|
  Fly    13 VAAGSAKKDS-----EDPDHIITNGSPAYEGQAPYVVGMAF------GQSNIWCSGTIIGDTWIL 66

  Fly   106 TAAHCLNVND---FYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNG 167
            |:|.||..:.   .|....||.:      ..:|                   :.|...:|.|.| 
  Fly    67 TSAQCLTGSSGVTIYFGATRLSQ------AQFT-------------------VTVGTSEYVTGN- 105

  Fly   168 RHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWG----DSGLQQKSTVLRQ 228
            :|   :||:|: .||.::.::..:.: |.:...:..::|:...:.|||    .:||   :..|:.
  Fly   106 QH---LALVRV-PRVGFSNRVNRVAL-PSLRNRSQRYENWWANVCGWGVTTFSNGL---TDALQC 162

  Fly   229 GTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSY 293
            ..:..||.:||:..|.:..|...| :|.....|..|..||:||||:..      |...:.||:::
  Fly   163 VDLQIMSNNECIAFYGSTTVSDQI-LCTRTPSGRSTCFGDAGSPLITK------QDSTVVGISAF 220

  Fly   294 -GGGPSSYGYGPAVYTKTSSYYEWIKKK 320
             .....:.|. ||.:.:.:|..:||.::
  Fly   221 VASNGCTLGL-PAGFARITSALDWIHQR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 61/265 (23%)
Tryp_SPc 62..317 CDD:214473 59/262 (23%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 61/264 (23%)
Tryp_SPc 29..244 CDD:214473 59/262 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.