DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:279 Identity:69/279 - (24%)
Similarity:103/279 - (36%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN---VNDFYVARVRL 123
            |..|..|:..:.|:||.||:..       ...|.||:|::.:||||.||:.   |..::.|..|.
  Fly    37 ITNGYPAEEGKAPYTVGLGFSG-------GWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRT 94

  Fly   124 GEHDTENDPDYTWLPNGAKIWAPAHVDIDVDL-RVPHEQYYTRNGR----HYNDIALLRLKSRVK 183
            ....|.      |:.:|..|   .|...|:.| |:||..::....:    .|||          :
  Fly    95 NAQFTH------WVGSGNFI---THGSADIALIRIPHVDFWHMVNKVELPSYND----------R 140

  Fly   184 YTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMS-PD---------- 237
            |                 :.:..:.....|||             ||..|.. ||          
  Fly   141 Y-----------------NDYNEWWAVACGWG-------------GTYDGSPLPDYLQCVDLQII 175

  Fly   238 ---ECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS 299
               ||.:.|.|..|..:| ||....||..|..||||.||:...|.      .|.|:|::..|...
  Fly   176 HNSECASYYGTGTVGDNI-ICVRVVDGKGTCGGDSGGPLVTHDGS------KLVGVTNWVSGAGC 233

  Fly   300 YGYGPAVYTKTSSYYEWIK 318
            ....||.:.:.:.:.:||:
  Fly   234 QAGHPAGFQRVTYHLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/279 (25%)
Tryp_SPc 62..317 CDD:214473 67/276 (24%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 67/276 (24%)
Tryp_SPc 37..254 CDD:238113 69/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.