DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG33460

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:100/260 - (38%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLP 138
            |||.||..:.       |..|||:||...::||||.|:..|   ..:|||||        :...|
  Fly    44 PWTALLHTDG-------SIFCAGTLITDVFILTAASCIRPN---AVKVRLGE--------FGRYP 90

  Fly   139 NGAKIWAPAHVDIDVDLRVPHEQYY------TRNGRHYNDIALLRLKSRVKYTLQIRPICIW--- 194
            |              :|...|..:|      ..|....|:|.||:|..||:.|..|.|:||.   
  Fly    91 N--------------ELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNP 141

  Fly   195 PGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGW 259
            ...:|||..|..     ..|.:......:..||...|.. .|..|.|      :|...|.|| |.
  Fly   142 QNQQLSTMRFIG-----NAWMEDSNVSLTKELRPIVIQS-KPKMCTN------LDLYTQFCA-GH 193

  Fly   260 DGTDTGL-GDSGSPLMASVGRGADQFYYLA-GITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKIN 322
            .|..... |.:||.|:.: .|..:::.::. ||.:..........|   ||....:|.||:..::
  Fly   194 QGNLRSCDGLTGSALIQN-SRYMNKYRHIQFGIATVNDMDCEESQG---YTDVLKFYWWIQDVVS 254

  Fly   323  322
              Fly   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/256 (27%)
Tryp_SPc 62..317 CDD:214473 68/253 (27%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 70/256 (27%)
Tryp_SPc 44..249 CDD:214473 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.